PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00870.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 502aa    MW: 55806.8 Da    PI: 7.6269
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00870.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.32.3e-16210249140
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              k++kgC+Ckks ClkkYCeC++a++ Cse+C+C+dCkN e
  Rsa1.0_00870.1_g00006.1 210 KHSKGCHCKKSGCLKKYCECYQANVLCSENCRCQDCKNFE 249
                              589***********************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163422.886129250IPR005172CRC domain
SMARTSM011148.5E-19210251IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12213248IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MEKSDHDLSS NRNPLARQLD FSAAAAAVET KMMDSSSQEG SEKNQSRSVI DSKGDQRDED  60
LASQEPSGTD ESGVKSVEQP PRSPVRSPQP SATEDVTPPP QRPPVHRFSH HPSGKCRVKS  120
KQEPLTPRGQ QQTTEAESKD GTPNKQKKHC NCKASRCLKL NNLENETARQ EAITGTLERN  180
PDAFKPKIAG SPHGITDLQE DVRQLLILGK HSKGCHCKKS GCLKKYCECY QANVLCSENC  240
RCQDCKNFEG NEERHALLHG SHHVSETYVQ HTTNAALNRA VSTSGFLNTP ESRKRKSKDA  300
SSAVPHLVQN QAVNRDTSLF SIPNNKAVSG PPTCTYRSSL SNTIQPRHVR DLCTLLVTKS  360
LDVENKYTDK RRKHENDPSL DPAQRDANEF NDSPDCVLDS TRMDEKPVSP ATRALMCDDE  420
HVITSEKETS ARVKASREKE EVDTSSEIYL EKERQILSSF RDFLIQLSNR GSIKGTNIKT  480
NTNPSRKEVP DEEQGHRDSS CG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1291296SRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728831e-105AC172883.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH125N23, complete sequence.
GenBankAC1893211e-105AC189321.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036J07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706329.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
RefseqXP_013703572.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
RefseqXP_013644023.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
SwissprotF4JY840.0TCX7_ARATH; Protein tesmin/TSO1-like CXC 7
TrEMBLA0A078CTS10.0A0A078CTS1_BRANA; BnaC07g29080D protein
STRINGBra009859.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134631628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25790.10.0Tesmin/TSO1-like CXC domain-containing protein